Nucleobindin 1 (NUCB1) (NM_006184) Human Mass Spec Standard

SKU
PH301786
NUCB1 MS Standard C13 and N15-labeled recombinant protein (NP_006175)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201786]
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC201786 protein sequence
Red=Cloning site Green=Tags(s)

MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFRE
KLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAEQDPNVQVDHLNLLKQFEH
LDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEEQQ
RRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPK
NEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRF
EEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006175
RefSeq Size 2585
RefSeq ORF 1383
Synonyms CALNUC; NUC
Locus ID 4924
UniProt ID Q02818
Cytogenetics 19q13.33
Summary This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:Nucleobindin 1 (NUCB1) (NM_006184) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416822 NUCB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416822 Transient overexpression lysate of nucleobindin 1 (NUCB1) 100 ug
$436.00
TP301786 Recombinant protein of human nucleobindin 1 (NUCB1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.