AHA1 (AHSA1) (NM_012111) Human Mass Spec Standard

SKU
PH301782
AHSA1 MS Standard C13 and N15-labeled recombinant protein (NP_036243)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201782]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC201782 protein sequence
Red=Cloning site Green=Tags(s)

MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI
NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG
VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT
LKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP
EGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036243
RefSeq Size 1429
RefSeq ORF 1014
Synonyms AHA1; C14orf3; hAha1; p38
Locus ID 10598
UniProt ID O95433
Cytogenetics 14q24.3
Summary Acts as a co-chaperone of HSP90AA1 (PubMed:29127155). Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity (PubMed:29127155). Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:27353360). Competes with the inhibitory co-chaperone TSC1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:29127155).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:AHA1 (AHSA1) (NM_012111) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402150 AHSA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402150 Transient overexpression lysate of AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1) 100 ug
$436.00
TP301782 Recombinant protein of human AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.