CRELD1 (NM_001031717) Human Mass Spec Standard

SKU
PH301774
CRELD1 MS Standard C13 and N15-labeled recombinant protein (NP_001026887)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201774]
Predicted MW 45.9 kDa
Protein Sequence
Protein Sequence
>RC201774 protein sequence
Red=Cloning site Green=Tags(s)

MAPWPPKGLVPAVLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGG
GNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLK
LCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLV
CSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLG
CMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPG
AFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRLIHSQQASS
QR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001026887
RefSeq Size 2406
RefSeq ORF 1266
Synonyms AVSD2; CIRRIN
Locus ID 78987
UniProt ID Q96HD1
Cytogenetics 3p25.3
Summary This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in this gene are the cause of atrioventricular septal defect. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CRELD1 (NM_001031717) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414506 CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421411 CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422168 CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414506 Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 2 100 ug
$665.00
LY421411 Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 3 100 ug
$665.00
LY422168 Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 1 100 ug
$436.00
TP301774 Recombinant protein of human cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.