DSCC1 (NM_024094) Human Mass Spec Standard

SKU
PH301714
DSCC1 MS Standard C13 and N15-labeled recombinant protein (NP_076999)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201714]
Predicted MW 44.8 kDa
Protein Sequence
Protein Sequence
>RC201714 protein sequence
Red=Cloning site Green=Tags(s)

MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGHSLVIRGDKDE
QAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKK
LLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEFDYEMKLLNHV
TQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNA
VKFNLAEFQEVWQQSVPEGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE
EDIAPYIQDLCGEKQTIGALLTKYSRSSMQNGVKVYNSRRPIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076999
RefSeq Size 2291
RefSeq ORF 1179
Synonyms DCC1
Locus ID 79075
UniProt ID Q9BVC3
Cytogenetics 8q24.12
Summary CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez et al., 2003 [PubMed 12930902]).[supplied by OMIM, Dec 2009]
Write Your Own Review
You're reviewing:DSCC1 (NM_024094) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411365 DSCC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411365 Transient overexpression lysate of defective in sister chromatid cohesion 1 homolog (S. cerevisiae) (DSCC1) 100 ug
$436.00
TP301714 Recombinant protein of human defective in sister chromatid cohesion 1 homolog (S. cerevisiae) (DSCC1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.