OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDLIM1 (NM_020992) Human Mass Spec Standard

Be the first to review this product
SKU
PH301674
PDLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_066272)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312393 Rabbit polyclonal anti-PDLIM1 antibody
100 ul
$380.00
LY402823 Transient overexpression lysate of PDZ and LIM domain 1 (PDLIM1) (as WB positive control) 100 ug
$436.00

Other products for "PDLIM1 or NM_020992"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201674
Predicted MW 36.1 kDa
Protein Sequence
Protein Sequence
>RC201674 protein sequence
Red=Cloning site Green=Tags(s)

MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI
KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI
TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP
KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH
PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066272
RefSeq Size 1598
RefSeq ORF 987
Synonyms CLIM1; CLP-36; CLP36; hCLIM1; HEL-S-112
Locus ID 9124
UniProt ID O00151
Cytogenetics 10q23.33
Summary This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cytoskeleton. The protein may function as an adapter to bring other LIM-interacting proteins to the cytoskeleton. Pseudogenes associated with this gene are located on chromosomes 3, 14 and 17. provided by RefSeq, Oct 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDLIM1" proteins (3)
SKU Description Size Price
LC402823 Lyophilized PDLIM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402823 Transient overexpression lysate of PDZ and LIM domain 1 (PDLIM1) (as WB positive control) 100 ug
$436.00
TP301674 Recombinant protein of human PDZ and LIM domain 1 (PDLIM1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products