PDLIM1 (NM_020992) Human Mass Spec Standard

SKU
PH301674
PDLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_066272)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201674]
Predicted MW 36.1 kDa
Protein Sequence
Protein Sequence
>RC201674 protein sequence
Red=Cloning site Green=Tags(s)

MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI
KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI
TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP
KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH
PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066272
RefSeq Size 1598
RefSeq ORF 987
Synonyms CLIM1; CLP-36; CLP36; hCLIM1; HEL-S-112
Locus ID 9124
UniProt ID O00151
Cytogenetics 10q23.33
Summary This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cytoskeleton. The protein may function as an adapter to bring other LIM-interacting proteins to the cytoskeleton. Pseudogenes associated with this gene are located on chromosomes 3, 14 and 17. [provided by RefSeq, Oct 2012]
Write Your Own Review
You're reviewing:PDLIM1 (NM_020992) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402823 PDLIM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402823 Transient overexpression lysate of PDZ and LIM domain 1 (PDLIM1) 100 ug
$436.00
TP301674 Recombinant protein of human PDZ and LIM domain 1 (PDLIM1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.