OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RFC3 (NM_002915) Human Mass Spec Standard

Be the first to review this product
SKU
PH301655
RFC3 MS Standard C13 and N15-labeled recombinant protein (NP_002906)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811874 RFC3 mouse monoclonal antibody,clone OTI3F6 100 ul
$447.00
LY405704 Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RFC3 or NM_002915"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201655
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC201655 protein sequence
Red=Cloning site Green=Tags(s)

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE
HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL
TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ
LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE
LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG
LEGMMF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002906
RefSeq Size 2396
RefSeq ORF 1068
Synonyms RFC38
Locus ID 5983
UniProt ID P40938
Cytogenetics 13q13.2
Summary The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. provided by RefSeq, Jul 2008
Protein Families Stem cell - Pluripotency
Protein Pathways DNA replication, Mismatch repair, Nucleotide excision repair
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RFC3" proteins (5)
SKU Description Size Price
LC405704 Lyophilized RFC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419018 Lyophilized RFC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405704 Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419018 Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301655 Recombinant protein of human replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products