PUS3 (NM_031307) Human Mass Spec Standard

SKU
PH301648
PUS3 MS Standard C13 and N15-labeled recombinant protein (NP_112597)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201648]
Predicted MW 55.6 kDa
Protein Sequence
Protein Sequence
>RC201648 protein sequence
Red=Cloning site Green=Tags(s)

MADNDTDRNQTEKLLKRVRELEQEVQRLKKEQAKNKEDSNIRENSSGAGKTKRAFDFSAHGRRHVALRIA
YMGWGYQGFASQENTNNTIEEKLFEALTKTRLVESRQTSNYHRCGRTDKGVSAFGQVISLDLRSQFPRGR
DSEDFNVKEEANAAAEEIRYTHILNRVLPPDIRILAWAPVEPSFSARFSCLERTYRYFFPRADLDIVTMD
YAAQKYVGTHDFRNLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVR
CMMAILFLIGQGMEKPEIIDELLNIEKNPQKPQYSMAVEFPLVLYDCKFENVKWIYDQEAQEFNITHLQQ
LWANHAVKTHMLYSMLQGLDTVPVPCGIGPKMDGMTEWGNVKPSVIKQTSAFVEGVKMRTYKPLMDRPKC
QGLESRIQHFVRRGRIEHPHLFHEEETKAKRDCNDTLEEDNTNLETPTKRVCVDTEIKSII

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112597
RefSeq Size 1862
RefSeq ORF 1443
Synonyms 2610020J05Rik; FKSG32; MRT55; NEDMIGS
Locus ID 83480
UniProt ID Q9BZE2
Cytogenetics 11q24.2
Summary The protein encoded by this gene catalyzes the formation of tRNA pseudouridine from tRNA uridine at position 39 in the anticodon stem and loop of transfer RNAs. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:PUS3 (NM_031307) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410557 PUS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410557 Transient overexpression lysate of pseudouridylate synthase 3 (PUS3) 100 ug
$436.00
TP301648 Recombinant protein of human pseudouridylate synthase 3 (PUS3), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.