SCAMP3 (NM_005698) Human Mass Spec Standard

SKU
PH301633
SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201633]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC201633 protein sequence
Red=Cloning site Green=Tags(s)

MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ
PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS
FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT
PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML
LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005689
RefSeq Size 1595
RefSeq ORF 1041
Synonyms C1orf3
Locus ID 10067
UniProt ID O14828
Cytogenetics 1q22
Summary This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SCAMP3 (NM_005698) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401740 SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409448 SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401740 Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 1 100 ug
$436.00
LY409448 Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 2 100 ug
$436.00
TP301633 Recombinant protein of human secretory carrier membrane protein 3 (SCAMP3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.