MNAT1 (NM_002431) Human Mass Spec Standard

SKU
PH301595
MNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_002422)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201595]
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC201595 protein sequence
Red=Cloning site Green=Tags(s)

MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK
EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKL
TREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM
QLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASP
QDLAGGYTSSLACHRALQDAFSGLFWQPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002422
RefSeq Size 1397
RefSeq ORF 927
Synonyms CAP35; MAT1; RNF66; TFB3
Locus ID 4331
UniProt ID P51948
Cytogenetics 14q23.1
Summary The protein encoded by this gene, along with cyclin H and CDK7, forms the CDK-activating kinase (CAK) enzymatic complex. This complex activates several cyclin-associated kinases and can also associate with TFIIH to activate transcription by RNA polymerase II. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Nucleotide excision repair
Write Your Own Review
You're reviewing:MNAT1 (NM_002431) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419334 MNAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432796 MNAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419334 Transient overexpression lysate of menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1) 100 ug
$436.00
LY432796 Transient overexpression lysate of menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), transcript variant 2 100 ug
$436.00
TP301595 Recombinant protein of human menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.