Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Mass Spec Standard

SKU
PH301580
HSF2BP MS Standard C13 and N15-labeled recombinant protein (NP_008962)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201580]
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC201580 protein sequence
Red=Cloning site Green=Tags(s)

MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQE
LEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEV
VKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVL
LDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQ
SVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008962
RefSeq Size 1916
RefSeq ORF 1002
Synonyms MEILB2; POF19
Locus ID 11077
UniProt ID O75031
Cytogenetics 21q22.3
Summary HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416250 HSF2BP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416250 Transient overexpression lysate of heat shock transcription factor 2 binding protein (HSF2BP) 100 ug
$436.00
TP301580 Recombinant protein of human heat shock transcription factor 2 binding protein (HSF2BP), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.