TRA2B (NM_004593) Human Mass Spec Standard

SKU
PH301542
TRA2B MS Standard C13 and N15-labeled recombinant protein (NP_004584)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201542]
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC201542 protein sequence
Red=Cloning site Green=Tags(s)

MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR
SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK
YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR
PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS
RSYSPRRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004584
RefSeq Size 4290
RefSeq ORF 864
Synonyms Htra2-beta; PPP1R156; SFRS10; SRFS10; TRA2-BETA; TRAN2B
Locus ID 6434
UniProt ID P62995
Cytogenetics 3q27.2
Summary This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:TRA2B (NM_004593) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401456 TRA2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401456 Transient overexpression lysate of transformer 2 beta homolog (Drosophila) (TRA2B) 100 ug
$436.00
TP301542 Recombinant protein of human transformer 2 beta homolog (Drosophila) (TRA2B), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.