SGK1 (NM_005627) Human Mass Spec Standard

SKU
PH301535
SGK1 MS Standard C13 and N15-labeled recombinant protein (NP_005618)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201535]
Predicted MW 48.9 kDa
Protein Sequence
Protein Sequence
>RC201535 protein sequence
Red=Cloning site Green=Tags(s)

MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMN
ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEE
KHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL
GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDW
WCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIK
SHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005618
RefSeq Size 2414
RefSeq ORF 1293
Synonyms SGK
Locus ID 6446
UniProt ID O00141
Cytogenetics 6q23.2
Summary This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:SGK1 (NM_005627) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417159 SGK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428312 SGK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428314 SGK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417159 Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1 100 ug
$436.00
LY428312 Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 2 100 ug
$436.00
LY428314 Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 4 100 ug
$436.00
TP301535 Recombinant protein of human serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.