OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERLEC1 (NM_015701) Human Mass Spec Standard

Be the first to review this product
SKU
PH301486
ERLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_056516)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333792 Rabbit Polyclonal Anti-ERLEC1 Antibody
100 ul
$585.00
LY426779 Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ERLEC1 or NM_015701"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201486
Predicted MW 54.9 kDa
Protein Sequence
Protein Sequence
>RC201486 protein sequence
Red=Cloning site Green=Tags(s)

MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT
TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET
GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST
VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ
EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG
WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056516
RefSeq Size 2605
RefSeq ORF 1449
Synonyms C2orf30; CIM; CL24936; CL25084; HEL117; XTP3-B; XTP3TPB
Locus ID 27248
UniProt ID Q96DZ1
Cytogenetics 2p16.2
Summary This gene encodes a resident endoplasmic reticulum (ER) protein that functions in N-glycan recognition. This protein is thought to be involved in ER-associated degradation via its interaction with the membrane-associated ubiquitin ligase complex. It also functions as a regulator of multiple cellular stress-response pathways in a manner that promotes metastatic cell survival. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 21. provided by RefSeq, Aug 2011
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERLEC1" proteins (5)
SKU Description Size Price
LC414394 Lyophilized ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426779 Lyophilized ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414394 Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426779 Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301486 Recombinant protein of human chromosome 2 open reading frame 30 (C2orf30), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products