ERLEC1 (NM_015701) Human Mass Spec Standard

SKU
PH301486
ERLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_056516)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201486]
Predicted MW 54.9 kDa
Protein Sequence
Protein Sequence
>RC201486 protein sequence
Red=Cloning site Green=Tags(s)

MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT
TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET
GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST
VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ
EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG
WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056516
RefSeq Size 2605
RefSeq ORF 1449
Synonyms C2orf30; CIM; CL24936; CL25084; HEL117; XTP3-B; XTP3TPB
Locus ID 27248
UniProt ID Q96DZ1
Cytogenetics 2p16.2
Summary This gene encodes a resident endoplasmic reticulum (ER) protein that functions in N-glycan recognition. This protein is thought to be involved in ER-associated degradation via its interaction with the membrane-associated ubiquitin ligase complex. It also functions as a regulator of multiple cellular stress-response pathways in a manner that promotes metastatic cell survival. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 21. [provided by RefSeq, Aug 2011]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:ERLEC1 (NM_015701) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414394 ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426779 ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414394 Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 1 100 ug
$436.00
LY426779 Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 2 100 ug
$436.00
TP301486 Recombinant protein of human chromosome 2 open reading frame 30 (C2orf30), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.