PSF3 (GINS3) (NM_022770) Human Mass Spec Standard

SKU
PH301425
GINS3 MS Standard C13 and N15-labeled recombinant protein (NP_073607)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201425]
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC201425 protein sequence
Red=Cloning site Green=Tags(s)

MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPL
WLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQ
TFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRK
FTDMED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073607
RefSeq Size 2297
RefSeq ORF 648
Synonyms PSF3
Locus ID 64785
UniProt ID Q9BRX5
Cytogenetics 16q21
Summary This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PSF3 (GINS3) (NM_022770) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411561 GINS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411561 Transient overexpression lysate of GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2 100 ug
$436.00
TP301425 Recombinant protein of human GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.