FOXS1 (NM_004118) Human Mass Spec Standard

SKU
PH301400
FOXS1 MS Standard C13 and N15-labeled recombinant protein (NP_004109)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201400]
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC201400 protein sequence
Red=Cloning site Green=Tags(s)

MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL
SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQD
PGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVAT
SSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPT
PPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004109
RefSeq Size 1353
RefSeq ORF 990
Synonyms FKHL18; FREAC10
Locus ID 2307
UniProt ID O43638
Cytogenetics 20q11.21
Summary The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:FOXS1 (NM_004118) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418193 FOXS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418193 Transient overexpression lysate of forkhead box S1 (FOXS1) 100 ug
$436.00
TP301400 Recombinant protein of human forkhead box S1 (FOXS1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.