EIF4EL3 (EIF4E2) (NM_004846) Human Mass Spec Standard

SKU PH301391

EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201391]
• Predicted MW: 28.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC201391 protein sequence; Red=Cloning site Green=Tags(s); ; MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG; RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR; KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT; IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004837
• RefSeq Size: 1078
• RefSeq ORF: 735
• Synonyms: 4E-LP; 4EHP; EIF4EL3; h4EHP; IF4e
• Locus ID: 9470
• UniProt ID: O60573
• Cytogenetics: 2q37.1
• Summary: Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:9582349, PubMed:17368478, PubMed:25624349). Acts as a repressor of translation initiation (PubMed:22751931). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors
• Protein Pathways: Insulin signaling pathway, mTOR signaling pathway