OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF4EL3 (EIF4E2) (NM_004846) Human Mass Spec Standard

Be the first to review this product
SKU
PH301391
EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502403 EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11) 100 ul
$447.00
LY401518 Transient overexpression lysate of eukaryotic translation initiation factor 4E family member 2 (EIF4E2) (as WB positive control) 100 ug
$436.00

Other products for "EIF4EL3 or NM_004846"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201391
Predicted MW 28.4 kDa
Protein Sequence
Protein Sequence
>RC201391 protein sequence
Red=Cloning site Green=Tags(s)

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG
RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR
KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT
IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004837
RefSeq Size 1078
RefSeq ORF 735
Synonyms 4E-LP; 4EHP; EIF4EL3; h4EHP; IF4e
Locus ID 9470
UniProt ID O60573
Cytogenetics 2q37.1
Summary Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:9582349, PubMed:17368478, PubMed:25624349). Acts as a repressor of translation initiation (PubMed:22751931). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Protein Pathways Insulin signaling pathway, mTOR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF4EL3" proteins (3)
SKU Description Size Price
LC401518 Lyophilized EIF4E2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401518 Transient overexpression lysate of eukaryotic translation initiation factor 4E family member 2 (EIF4E2) (as WB positive control) 100 ug
$436.00
TP301391 Recombinant protein of human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products