AP2M1 (NM_001025205) Human Mass Spec Standard

SKU
PH301377
AP2M1 MS Standard C13 and N15-labeled recombinant protein (NP_001020376)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201377]
Predicted MW 49.2 kDa
Protein Sequence
Protein Sequence
>RC201377 representing NM_001025205
Red=Cloning site Green=Tags(s)

MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTK
QNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKS
QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP
ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT
KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENA
IVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020376
RefSeq Size 1952
RefSeq ORF 1305
Synonyms AP50; CLAPM1; MRD60; mu2
Locus ID 1173
UniProt ID Q96CW1
Cytogenetics 3q27.1
Summary This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
Protein Families Druggable Genome
Protein Pathways Endocytosis, Huntington's disease
Write Your Own Review
You're reviewing:AP2M1 (NM_001025205) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418234 AP2M1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422484 AP2M1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418234 Transient overexpression lysate of adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 1 100 ug
$436.00
LY422484 Transient overexpression lysate of adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 2 100 ug
$436.00
TP301377 Recombinant protein of human adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.