SCGN (NM_006998) Human Mass Spec Standard

SKU
PH301359
SCGN MS Standard C13 and N15-labeled recombinant protein (NP_008929)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201359]
Predicted MW 31.9 kDa
Protein Sequence
Protein Sequence
>RC201359 representing NM_006998
Red=Cloning site Green=Tags(s)

MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ
DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH
HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD
VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008929
RefSeq Size 1492
RefSeq ORF 828
Synonyms CALBL; DJ501N12.8; SECRET; SEGN; setagin
Locus ID 10590
UniProt ID O76038
Cytogenetics 6p22.2
Summary The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SCGN (NM_006998) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416264 SCGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416264 Transient overexpression lysate of secretagogin, EF-hand calcium binding protein (SCGN) 100 ug
$436.00
TP301359 Purified recombinant protein of Homo sapiens secretagogin, EF-hand calcium binding protein (SCGN), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.