APPBP1 (NAE1) (NM_001018160) Human Mass Spec Standard

SKU
PH301326
NAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001018170)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201326]
Predicted MW 60.2 kDa
Protein Sequence
Protein Sequence
>RC201326 protein sequence
Red=Cloning site Green=Tags(s)

MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDA
GNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLA
DVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHS
HTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQ
IPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKA
KKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEP
HTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018170
RefSeq Size 1716
RefSeq ORF 1602
Synonyms A-116A10.1; APPBP1; HPP1; ula-1
Locus ID 8883
UniProt ID Q13564
Cytogenetics 16q22.1
Summary The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Alzheimer's disease
Write Your Own Review
You're reviewing:APPBP1 (NAE1) (NM_001018160) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418361 NAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422668 NAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418361 Transient overexpression lysate of NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1 100 ug
$436.00
LY422668 Transient overexpression lysate of NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3 100 ug
$436.00
TP301326 Recombinant protein of human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.