Galactosidase alpha (GLA) (NM_000169) Human Mass Spec Standard

SKU
PH301304
GLA MS Standard C13 and N15-labeled recombinant protein (NP_000160)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201304]
Predicted MW 48.8 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC201304
Blue=ORF Red=Cloning site Green=Tag(s)

MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLF
MEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVG
NKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLY
MWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLS
WNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLS
GLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVL
LQLENTMQMSLKDLL

myc-FLAG tag

Recombinant protein using RC201304 also available, TP301304
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000160
RefSeq Size 1418
RefSeq ORF 1287
Synonyms GALA
Locus ID 2717
UniProt ID P06280
Cytogenetics Xq22.1
Summary This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Galactose metabolism, Glycerolipid metabolism, Glycosphingolipid biosynthesis - globo series, Lysosome, Sphingolipid metabolism
Write Your Own Review
You're reviewing:Galactosidase alpha (GLA) (NM_000169) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400067 GLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400067 Transient overexpression lysate of galactosidase, alpha (GLA) 100 ug
$436.00
TP301304 Recombinant protein of human galactosidase, alpha (GLA), 20 µg 20 ug
$867.00
TP720304 Recombinant protein of human galactosidase, alpha (GLA) 10 ug
$285.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.