TFIIF (GTF2F1) (NM_002096) Human Mass Spec Standard

SKU
PH301294
GTF2F1 MS Standard C13 and N15-labeled recombinant protein (NP_002087)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201294]
Predicted MW 58.2 kDa
Protein Sequence
Protein Sequence
>RC201294 protein sequence
Red=Cloning site Green=Tags(s)

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE
FNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPV
HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDL
EDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS
SQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE
SDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV
NVLAQILKRLNPERKMINDKMHFSLKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002087
RefSeq Size 2551
RefSeq ORF 1551
Synonyms BTF4; RAP74; TF2F1; TFIIF
Locus ID 2962
UniProt ID P35269
Cytogenetics 19p13.3
Summary TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors
Write Your Own Review
You're reviewing:TFIIF (GTF2F1) (NM_002096) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400767 GTF2F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400767 Transient overexpression lysate of general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1) 100 ug
$436.00
TP301294 Recombinant protein of human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.