POLR2E (NM_002695) Human Mass Spec Standard

SKU
PH301266
POLR2E MS Standard C13 and N15-labeled recombinant protein (NP_002686)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201266]
Predicted MW 24.6 kDa
Protein Sequence
Protein Sequence
>RC201266 protein sequence
Red=Cloning site Green=Tags(s)

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTD
QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINIT
EHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002686
RefSeq Size 2866
RefSeq ORF 630
Synonyms hRPB25; hsRPB5; RPABC1; RPB5; XAP4
Locus ID 5434
UniProt ID P19388
Cytogenetics 19p13.3
Summary This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Write Your Own Review
You're reviewing:POLR2E (NM_002695) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419161 POLR2E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419161 Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E) 100 ug
$436.00
TP301266 Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.