OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CRIP1 (NM_001311) Human Mass Spec Standard

Be the first to review this product
SKU
PH301217
CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339220 Rabbit Polyclonal Anti-CRIP1
100 ul
$585.00
LY420018 Transient overexpression lysate of cysteine-rich protein 1 (intestinal) (CRIP1) (as WB positive control) 100 ug
$436.00

Other products for "CRIP1 or NM_001311"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201217
Predicted MW 8.5 kDa
Protein Sequence
Protein Sequence
>RC201217 protein sequence
Red=Cloning site Green=Tags(s)

MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG
AESHTFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001302
RefSeq Size 480
RefSeq ORF 231
Synonyms CRHP; CRIP; CRP-1; CRP1
Locus ID 1396
UniProt ID P50238
Cytogenetics 14q32.33
Summary Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 PubMed 1946385).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CRIP1" proteins (3)
SKU Description Size Price
LC420018 Lyophilized CRIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420018 Transient overexpression lysate of cysteine-rich protein 1 (intestinal) (CRIP1) (as WB positive control) 100 ug
$436.00
TP301217 Recombinant protein of human cysteine-rich protein 1 (intestinal) (CRIP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products