CDK2AP2 (NM_005851) Human Mass Spec Standard

SKU
PH301178
CDK2AP2 MS Standard C13 and N15-labeled recombinant protein (NP_005842)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201178]
Predicted MW 13.1 kDa
Protein Sequence
Protein Sequence
>RC201178 protein sequence
Red=Cloning site Green=Tags(s)

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS
QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005842
RefSeq Size 1499
RefSeq ORF 378
Synonyms DOC-1R; p14
Locus ID 10263
UniProt ID O75956
Cytogenetics 11q13.2
Summary This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:CDK2AP2 (NM_005851) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417039 CDK2AP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417039 Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 2 (CDK2AP2) 100 ug
$436.00
TP301178 Recombinant protein of human cyclin-dependent kinase 2 associated protein 2 (CDK2AP2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.