BAT4 (GPANK1) (NM_033177) Human Mass Spec Standard

SKU
PH301161
BAT4 MS Standard C13 and N15-labeled recombinant protein (NP_149417)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201161]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC201161 protein sequence
Red=Cloning site Green=Tags(s)

MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGDESSAPDSQRSQTEPARERKR
KKRRIMKAPAAEAVAEGASGRHGQGRSLEAEDKMTHRILRAAQEGDLPELRRLLEPHEAGGAGGNINARD
AFWWTPLMCAARAGQGAAVSYLLGRGAAWVGVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRS
PTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEG
RANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRT
YMNLEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149417
RefSeq Size 2769
RefSeq ORF 1068
Synonyms ANKRD59; BAT4; D6S54E; G5; GPATCH10
Locus ID 7918
UniProt ID O95872
Cytogenetics 6p21.33
Summary This gene is located in a cluster of HLA-B-associated transcripts, which is included in the human major histocompatability complex III region. This gene encodes a protein which is thought to play a role in immunity. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:BAT4 (GPANK1) (NM_033177) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409694 GPANK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409694 Transient overexpression lysate of HLA-B associated transcript 4 (BAT4) 100 ug
$436.00
TP301161 Recombinant protein of human HLA-B associated transcript 4 (BAT4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.