PRC1 (NM_003981) Human Mass Spec Standard

SKU
PH301141
PRC1 MS Standard C13 and N15-labeled recombinant protein (NP_003972)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201141]
Predicted MW 71.7 kDa
Protein Sequence
Protein Sequence
>RC201141 protein sequence
Red=Cloning site Green=Tags(s)

MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS
VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHY
DIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEELDHTPDTSFERDVVCEDEDAFCL
SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD
RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE
LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT
TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGY
PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003972
RefSeq Size 3207
RefSeq ORF 1860
Synonyms ASE1
Locus ID 9055
UniProt ID O43663
Cytogenetics 15q26.1
Summary This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:PRC1 (NM_003981) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404548 PRC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404549 PRC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418307 PRC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404548 Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 2 100 ug
$665.00
LY404549 Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 3 100 ug
$665.00
LY418307 Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 1 100 ug
$436.00
TP301141 Recombinant protein of human protein regulator of cytokinesis 1 (PRC1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.