Tropomodulin 1 (TMOD1) (NM_003275) Human Mass Spec Standard

SKU
PH301134
TMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_003266)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201134]
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC201134 protein sequence
Red=Cloning site Green=Tags(s)

MSYRRELEKYRDLDEDKILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH
LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL
MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI
PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT
SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP
IIPKCRSGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003266
RefSeq Size 3352
RefSeq ORF 1077
Synonyms D9S57E; ETMOD; TMOD
Locus ID 7111
UniProt ID P28289
Cytogenetics 9q22.33
Summary This gene encodes a member of the tropomodulin family. The encoded protein is an actin-capping protein that regulates tropomyosin by binding to its N-terminus, inhibiting depolymerization and elongation of the pointed end of actin filaments and thereby influencing the structure of the erythrocyte membrane skeleton. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:Tropomodulin 1 (TMOD1) (NM_003275) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418797 TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431319 TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418797 Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 1 100 ug
$436.00
LY431319 Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 2 100 ug
$436.00
TP301134 Recombinant protein of human tropomodulin 1 (TMOD1), 20 µg 20 ug
$737.00
TP328291 Recombinant protein of human tropomodulin 1 (TMOD1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.