AP2B1 (NM_001030006) Human Mass Spec Standard

SKU
PH301129
AP2B1 MS Standard C13 and N15-labeled recombinant protein (NP_001025177)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201129]
Predicted MW 105.5 kDa
Protein Sequence
Protein Sequence
>RC201129 representing NM_001030006
Red=Cloning site Green=Tags(s)

MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVY
LYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKT
AAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA
LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNML
LKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQAN
IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVK
LFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLL
DELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGD
LLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV
SSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQ
FNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNG
IWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001025177
RefSeq Size 5772
RefSeq ORF 2853
Synonyms ADTB2; AP2-BETA; AP105B; CLAPB1
Locus ID 163
UniProt ID P63010
Cytogenetics 17q12
Summary The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Endocytosis, Huntington's disease
Write Your Own Review
You're reviewing:AP2B1 (NM_001030006) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315791 AP2B1 MS Standard C13 and N15-labeled recombinant protein (NP_001273) 10 ug
$3,255.00
LC420031 AP2B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422286 AP2B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429059 AP2B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420031 Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2 100 ug
$665.00
LY422286 Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1 100 ug
$436.00
LY429059 Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2 100 ug
$665.00
TP301129 Recombinant protein of human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 20 µg 20 ug
$737.00
TP315791 Recombinant protein of human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.