DAP1 (DAP) (NM_004394) Human Mass Spec Standard

SKU PH301120

DAP MS Standard C13 and N15-labeled recombinant protein (NP_004385)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201120]
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC201120 protein sequence; Red=Cloning site Green=Tags(s); ; MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDF; PPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004385
• RefSeq Size: 2385
• RefSeq ORF: 306
• Locus ID: 1611
• UniProt ID: P51397
• Cytogenetics: 5p15.2
• Summary: This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]