POLR2D (NM_004805) Human Mass Spec Standard

SKU
PH301116
POLR2D MS Standard C13 and N15-labeled recombinant protein (NP_004796)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201116]
Predicted MW 16.3 kDa
Protein Sequence
Protein Sequence
>RC201116 protein sequence
Red=Cloning site Green=Tags(s)

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR
FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF
QY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004796
RefSeq Size 2338
RefSeq ORF 426
Synonyms HSRBP4; HSRPB4; RBP4; RPB4; RPB16
Locus ID 5433
UniProt ID O15514
Cytogenetics 2q14.3
Summary This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Write Your Own Review
You're reviewing:POLR2D (NM_004805) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417740 POLR2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417740 Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide D (POLR2D) 100 ug
$436.00
TP301116 Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.