PEX16 (NM_004813) Human Mass Spec Standard

SKU
PH301115
PEX16 MS Standard C13 and N15-labeled recombinant protein (NP_004804)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201115]
Predicted MW 38.6 kDa
Protein Sequence
Protein Sequence
>RC201115 protein sequence
Red=Cloning site Green=Tags(s)

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELR
KKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMLLLLWFKAGLQTSPP
IVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATP
TPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTIL
LLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004804
RefSeq Size 1929
RefSeq ORF 1008
Synonyms PBD8A; PBD8B
Locus ID 9409
UniProt ID Q9Y5Y5
Cytogenetics 11p11.2
Summary The protein encoded by this gene is an integral peroxisomal membrane protein. An inactivating nonsense mutation localized to this gene was observed in a patient with Zellweger syndrome of the complementation group CGD/CG9. Expression of this gene product morphologically and biochemically restores the formation of new peroxisomes, suggesting a role in peroxisome organization and biogenesis. Alternative splicing has been observed for this gene and two variants have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PEX16 (NM_004813) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409272 PEX16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417729 PEX16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409272 Transient overexpression lysate of peroxisomal biogenesis factor 16 (PEX16), transcript variant 2 100 ug
$436.00
LY417729 Transient overexpression lysate of peroxisomal biogenesis factor 16 (PEX16), transcript variant 1 100 ug
$436.00
TP301115 Recombinant protein of human peroxisomal biogenesis factor 16 (PEX16), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.