Cortactin (CTTN) (NM_138565) Human Mass Spec Standard

SKU
PH301111
CTTN MS Standard C13 and N15-labeled recombinant protein (NP_612632)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201111]
Predicted MW 57.5 kDa
Protein Sequence
Protein Sequence
>RC201111 protein sequence
Red=Cloning site Green=Tags(s)

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK
EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE
YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA
VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRM
DKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA
RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS
SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD
GWWRGVCKGRYGLFPANYVELRQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612632
RefSeq Size 3208
RefSeq ORF 1539
Synonyms EMS1
Locus ID 2017
UniProt ID Q14247
Cytogenetics 11q13.3
Summary This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010]
Protein Families Druggable Genome
Protein Pathways Pathogenic Escherichia coli infection, Tight junction
Write Your Own Review
You're reviewing:Cortactin (CTTN) (NM_138565) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403359 CTTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417430 CTTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429248 CTTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403359 Transient overexpression lysate of cortactin (CTTN), transcript variant 2 100 ug
$436.00
LY417430 Transient overexpression lysate of cortactin (CTTN), transcript variant 1 100 ug
$665.00
LY429248 Transient overexpression lysate of cortactin (CTTN), transcript variant 1 100 ug
$436.00
TP301111 Recombinant protein of human cortactin (CTTN), transcript variant 2, 20 µg 20 ug
$867.00
TP710315 Purified recombinant protein of Human cortactin (CTTN / EMS1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.