ACAA2 (NM_006111) Human Mass Spec Standard

SKU
PH301096
ACAA2 MS Standard C13 and N15-labeled recombinant protein (NP_006102)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201096]
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC201096 protein sequence
Red=Cloning site Green=Tags(s)

MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA
RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS
DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT
KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV
GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL
GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006102
RefSeq Size 1952
RefSeq ORF 1191
Synonyms DSAEC
Locus ID 10449
UniProt ID P42765
Cytogenetics 18q21.1
Summary The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
Protein Pathways Fatty acid elongation in mitochondria, Fatty acid metabolism, leucine and isoleucine degradation, Metabolic pathways, Valine
Write Your Own Review
You're reviewing:ACAA2 (NM_006111) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401843 ACAA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401843 Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 2 (ACAA2), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP301096 Recombinant protein of human acetyl-Coenzyme A acyltransferase 2 (ACAA2), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.