NSE (ENO2) (NM_001975) Human Mass Spec Standard

SKU
PH301085
ENO2 MS Standard C13 and N15-labeled recombinant protein (NP_001966)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201085]
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC201085 protein sequence
Red=Cloning site Green=Tags(s)

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001966
RefSeq Size 2423
RefSeq ORF 1302
Synonyms HEL-S-279; NSE
Locus ID 2026
UniProt ID P09104
Cytogenetics 12p13.31
Summary This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation
Write Your Own Review
You're reviewing:NSE (ENO2) (NM_001975) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400724 ENO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400724 Transient overexpression lysate of enolase 2 (gamma, neuronal) (ENO2) 100 ug
$436.00
TP301085 Recombinant protein of human enolase 2 (gamma, neuronal) (ENO2), 20 µg 20 ug
$737.00
TP762399 Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Asn220-Val433, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762452 Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Val188-Glu293, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.