TMEM70 (NM_017866) Human Mass Spec Standard

SKU
PH301060
TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201060]
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC201060 protein sequence
Red=Cloning site Green=Tags(s)

MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQ
IPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPI
QIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFT
TFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060336
RefSeq Size 2096
RefSeq ORF 780
Synonyms MC5DN2
Locus ID 54968
UniProt ID Q9BUB7
Cytogenetics 8q21.11
Summary This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM70 (NM_017866) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413488 TMEM70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421778 TMEM70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413488 Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 1 100 ug
$436.00
LY421778 Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 2 100 ug
$436.00
TP301060 Recombinant protein of human transmembrane protein 70 (TMEM70), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.