CEP55 (NM_018131) Human Mass Spec Standard

SKU
PH301052
CEP55 MS Standard C13 and N15-labeled recombinant protein (NP_060601)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201052]
Predicted MW 54.1 kDa
Protein Sequence
Protein Sequence
>RC201052 protein sequence
Red=Cloning site Green=Tags(s)

MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK
EKNAYQLTEKDKEIQRLRDQLKARYSTTALLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA
ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE
TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN
QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA
LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060601
RefSeq Size 2656
RefSeq ORF 1392
Synonyms C10orf3; CT111; MARCH; URCC6
Locus ID 55165
UniProt ID Q53EZ4
Cytogenetics 10q23.33
Summary Plays a role in mitotic exit and cytokinesis (PubMed:16198290, PubMed:17853893). Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis (PubMed:17853893). Not required for microtubule nucleation (PubMed:16198290). Plays a role in the development of the brain and kidney (PubMed:28264986).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CEP55 (NM_018131) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413284 CEP55 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426692 CEP55 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413284 Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 1 100 ug
$436.00
LY426692 Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 2 100 ug
$436.00
TP301052 Recombinant protein of human centrosomal protein 55kDa (CEP55), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761544 Purified recombinant protein of Human centrosomal protein 55kDa (CEP55), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.