OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CENPM (NM_024053) Human Mass Spec Standard

Be the first to review this product
SKU
PH301047
CENPM MS Standard C13 and N15-labeled recombinant protein (NP_076958)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349793 Rabbit Polyclonal Anti-CENPM Antibody
100 ul
$205.00
LY411372 Transient overexpression lysate of centromere protein M (CENPM), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CENPM or NM_024053"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201047
Predicted MW 19.7 kDa
Protein Sequence
Protein Sequence
>RC201047 protein sequence
Red=Cloning site Green=Tags(s)

MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV
NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA
TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076958
RefSeq Size 947
RefSeq ORF 540
Synonyms C22orf18; CENP-M; PANE1
Locus ID 79019
UniProt ID Q9NSP4
Cytogenetics 22q13.2
Summary The protein encoded by this gene is an inner protein of the kinetochore, the multi-protein complex that binds spindle microtubules to regulate chromosome segregation during cell division. It belongs to the constitutive centromere-associated network protein group, whose members interact with outer kinetochore proteins and help to maintain centromere identity at each cell division cycle. The protein is structurally related to GTPases but cannot bind guanosine triphosphate. A point mutation that affects interaction with another constitutive centromere-associated network protein, CENP-I, impairs kinetochore assembly and chromosome alignment, suggesting that it is required for kinetochore formation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CENPM" proteins (5)
SKU Description Size Price
LC411372 Lyophilized CENPM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426315 Lyophilized CENPM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411372 Transient overexpression lysate of centromere protein M (CENPM), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426315 Transient overexpression lysate of centromere protein M (CENPM), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301047 Recombinant protein of human centromere protein M (CENPM), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products