WT1-AS (NM_015855) Human Mass Spec Standard

SKU PH301018

WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201018]
• Predicted MW: 9.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC201018 representing NM_015855; Red=Cloning site Green=Tags(s); ; MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP; QPQGPVRTPGPPSGSHPAAADN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_056939
• RefSeq Size: 1962
• RefSeq ORF: 276
• Synonyms: WIT-1, dJ74J1.1, MGC120207, MGC120208, MGC120209
• Locus ID: 51352
• Cytogenetics: 11p13
• Summary: This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis. [provided by RefSeq, May 2014]
• Protein Families: Druggable Genome