GTL3 (CFAP20) (NM_013242) Human Mass Spec Standard

SKU
PH301017
C16orf80 MS Standard C13 and N15-labeled recombinant protein (NP_037374)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201017]
Predicted MW 22.8 kDa
Protein Sequence
Protein Sequence
>RC201017 protein sequence
Red=Cloning site Green=Tags(s)

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG
IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT
RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037374
RefSeq Size 1308
RefSeq ORF 579
Synonyms BUG22; C16orf80; EVORF; fSAP23; GTL3
Locus ID 29105
UniProt ID Q9Y6A4
Cytogenetics 16q21
Summary Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia (PubMed:24414207). Required for axonemal microtubules polyglutamylation (PubMed:24414207).[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:GTL3 (CFAP20) (NM_013242) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415720 CFAP20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415720 Transient overexpression lysate of chromosome 16 open reading frame 80 (C16orf80) 100 ug
$436.00
TP301017 Recombinant protein of human chromosome 16 open reading frame 80 (C16orf80), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.