RBMS1 (NM_002897) Human Mass Spec Standard

SKU
PH301015
RBMS1 MS Standard C13 and N15-labeled recombinant protein (NP_002888)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201015]
Predicted MW 44.1 kDa
Protein Sequence
Protein Sequence
>RC201015 protein sequence
Red=Cloning site Green=Tags(s)

MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLP
PHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP
TNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPP
GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTTAAIQNGFYPSPYSIATNRMI
TQTSITPYIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTG
TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002888
RefSeq Size 4296
RefSeq ORF 1209
Synonyms C2orf12; HCC-4; MSSP; MSSP-1; MSSP-2; MSSP-3; SCR2; YC1
Locus ID 5937
UniProt ID P29558
Cytogenetics 2q24.2
Summary This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:RBMS1 (NM_002897) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413821 RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413822 RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419042 RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413821 Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 1 100 ug
$436.00
LY413822 Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 2 100 ug
$436.00
LY419042 Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 3 100 ug
$436.00
TP301015 Recombinant protein of human RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760059 Recombinant protein of human RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.