WDR18 (NM_024100) Human Mass Spec Standard

SKU
PH301008
WDR18 MS Standard C13 and N15-labeled recombinant protein (NP_077005)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201008]
Predicted MW 47.4 kDa
Protein Sequence
Protein Sequence
>RC201008 protein sequence
Red=Cloning site Green=Tags(s)

MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAWELQRK
DQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRHYQDVSCLQFTGDSSHFISGG
KDCLVLVWSLCSVLQADPSRIPAPRHVWSHHTLPITDLHCGFGGPLARVATSSLDQTVKLWEVSSGELLL
SVLFDVSIMAVTMDLAEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTD
GSVLLSGSHDETVRLWDVQSKQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGD
EPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLF
DFSTRFITRPAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077005
RefSeq Size 1551
RefSeq ORF 1296
Synonyms Ipi3; R32184_1
Locus ID 57418
UniProt ID Q9BV38
Cytogenetics 19p13.3
Summary This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:WDR18 (NM_024100) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411371 WDR18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411371 Transient overexpression lysate of WD repeat domain 18 (WDR18) 100 ug
$436.00
TP301008 Recombinant protein of human WD repeat domain 18 (WDR18), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.