Mutarotase (GALM) (NM_138801) Human Mass Spec Standard

SKU
PH300995
GALM MS Standard C13 and N15-labeled recombinant protein (NP_620156)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200995]
Predicted MW 37.8 kDa
Protein Sequence
Protein Sequence
>RC200995 protein sequence
Red=Cloning site Green=Tags(s)

MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQP
YFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGY
PGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIP
TGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF
YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620156
RefSeq Size 2483
RefSeq ORF 1026
Synonyms BLOCK25; GALAC4; GLAT; HEL-S-63p; IBD1
Locus ID 130589
UniProt ID Q96C23
Cytogenetics 2p22.1
Summary This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.[provided by RefSeq, Mar 2009]
Protein Pathways Glycolysis / Gluconeogenesis
Write Your Own Review
You're reviewing:Mutarotase (GALM) (NM_138801) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408487 GALM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408487 Transient overexpression lysate of galactose mutarotase (aldose 1-epimerase) (GALM) 100 ug
$436.00
TP300995 Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720250 Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.