POLR3GL (NM_032305) Human Mass Spec Standard

SKU
PH300991
POLR3GL MS Standard C13 and N15-labeled recombinant protein (NP_115681)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200991]
Predicted MW 25.3 kDa
Protein Sequence
Protein Sequence
>RC200991 protein sequence
Red=Cloning site Green=Tags(s)

MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGA
MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKT
TEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD
DNMDEAIY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115681
RefSeq Size 1191
RefSeq ORF 654
Synonyms flj32422; RPC32HOM
Locus ID 84265
UniProt ID Q9BT43
Cytogenetics 1q21.1
Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.[UniProtKB/Swiss-Prot Function]
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Write Your Own Review
You're reviewing:POLR3GL (NM_032305) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410247 POLR3GL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410247 Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL) 100 ug
$436.00
TP300991 Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.