GDAP1L1 (NM_024034) Human Mass Spec Standard

SKU
PH300976
GDAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_076939)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200976]
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>RC200976 protein sequence
Red=Cloning site Green=Tags(s)

MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGL
VCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHA
RVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSK
QKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRL
KFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGS
LGGMGYFAYWYLKKKYI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076939
RefSeq Size 2798
RefSeq ORF 1101
Synonyms dJ881L22.1; dJ995J12.1.1
Locus ID 78997
UniProt ID Q96MZ0
Cytogenetics 20q13.12
Summary The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein. Several transcript variants encoding different isoforms, as well as a noncoding transcript variant, have been found for this gene. [provided by RefSeq, Feb 2012]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GDAP1L1 (NM_024034) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411411 GDAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411411 Transient overexpression lysate of ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1) 100 ug
$436.00
TP300976 Recombinant protein of human ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.