OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDXK (NM_003681) Human Mass Spec Standard

Be the first to review this product
SKU
PH300975
PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502998 PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5) 100 ul
$447.00
LY418499 Transient overexpression lysate of pyridoxal (pyridoxine, vitamin B6) kinase (PDXK) (as WB positive control) 100 ug
$436.00

Other products for "PDXK or NM_003681"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200975
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC200975 protein sequence
Red=Cloning site Green=Tags(s)

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR
LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV
VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP
AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE
GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003672
RefSeq Size 7390
RefSeq ORF 936
Synonyms C21orf97; C21orf124; HEL-S-1a; HMSN6C; PKH; PNK; PRED79
Locus ID 8566
UniProt ID O00764
Cytogenetics 21q22.3
Summary The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Vitamin B6 metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDXK" proteins (3)
SKU Description Size Price
LC418499 Lyophilized PDXK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418499 Transient overexpression lysate of pyridoxal (pyridoxine, vitamin B6) kinase (PDXK) (as WB positive control) 100 ug
$436.00
TP300975 Recombinant protein of human pyridoxal (pyridoxine, vitamin B6) kinase (PDXK), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products