PDXK (NM_003681) Human Mass Spec Standard

SKU
PH300975
PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200975]
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC200975 protein sequence
Red=Cloning site Green=Tags(s)

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR
LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV
VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP
AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE
GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003672
RefSeq Size 7390
RefSeq ORF 936
Synonyms C21orf97; C21orf124; HEL-S-1a; HMSN6C; PKH; PNK; PRED79
Locus ID 8566
UniProt ID O00764
Cytogenetics 21q22.3
Summary The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Vitamin B6 metabolism
Write Your Own Review
You're reviewing:PDXK (NM_003681) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418499 PDXK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418499 Transient overexpression lysate of pyridoxal (pyridoxine, vitamin B6) kinase (PDXK) 100 ug
$436.00
TP300975 Recombinant protein of human pyridoxal (pyridoxine, vitamin B6) kinase (PDXK), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.