CPLX1 (NM_006651) Human Mass Spec Standard

SKU PH300969

CPLX1 MS Standard C13 and N15-labeled recombinant protein (NP_006642)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200969]
• Predicted MW: 15 kDa
• Protein Sequence:
  Protein Sequence

  >RC200969 protein sequence; Red=Cloning site Green=Tags(s); ; MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY; GIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006642
• RefSeq Size: 2200
• RefSeq ORF: 402
• Synonyms: CPX-I; CPX1; DEE63; EIEE63
• Locus ID: 10815
• UniProt ID: O14810
• Cytogenetics: 4p16.3
• Summary: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome