HTF9C (TRMT2A) (NM_182984) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200966] |
Predicted MW | 68.7 kDa |
Protein Sequence |
Protein Sequence
>RC200966 protein sequence
Red=Cloning site Green=Tags(s) MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTS EIFKLELQNVPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLS VRLARPKADPMARRRRQEGESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAKEIGSTNRALL PWLLEQRHKHNKACCPLEGVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVH IPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLA QHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVL YTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAE DLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKG IPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_892029 |
RefSeq Size | 2857 |
RefSeq ORF | 1875 |
Synonyms | HTF9C |
Locus ID | 27037 |
UniProt ID | Q8IZ69 |
Cytogenetics | 22q11.21 |
Summary | The protein encoded by this gene is of unknown function. However, it is orthologous to the mouse Trmt2a gene and contains an RNA methyltransferase domain. Expression of this gene varies during the cell cycle, with aberrant expression being a possible biomarker in certain breast cancers. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321181 | TRMT2A MS Standard C13 and N15-labeled recombinant protein (NP_073564) | 10 ug |
$3,255.00
|
|
LC405298 | TRMT2A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC411594 | TRMT2A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY405298 | Transient overexpression lysate of TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 2 | 100 ug |
$436.00
|
|
LY411594 | Transient overexpression lysate of TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 1 | 100 ug |
$665.00
|
|
TP300966 | Recombinant protein of human TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP321181 | Recombinant protein of human TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.