EFHD1 (NM_025202) Human Mass Spec Standard

SKU
PH300956
EFHD1 MS Standard C13 and N15-labeled recombinant protein (NP_079478)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200956]
Predicted MW 26.9 kDa
Protein Sequence
Protein Sequence
>RC200956 protein sequence
Red=Cloning site Green=Tags(s)

MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA
RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE
DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK
AEQDERKREEEERRLRQAAFQKLKANFNT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079478
RefSeq Size 2000
RefSeq ORF 717
Synonyms MST133; MSTP133; PP3051; SWS2
Locus ID 80303
UniProt ID Q9BUP0
Cytogenetics 2q37.1
Summary This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:EFHD1 (NM_025202) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403060 EFHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403060 Transient overexpression lysate of EF-hand domain family, member D1 (EFHD1), transcript variant 1 100 ug
$436.00
TP300956 Recombinant protein of human EF-hand domain family, member D1 (EFHD1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.