OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFHD1 (NM_025202) Human Mass Spec Standard

Be the first to review this product
SKU
PH300956
EFHD1 MS Standard C13 and N15-labeled recombinant protein (NP_079478)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812755 EFHD1 mouse monoclonal antibody,clone OTI8F3 100 ul
$447.00
LY403060 Transient overexpression lysate of EF-hand domain family, member D1 (EFHD1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "EFHD1 or NM_025202"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200956
Predicted MW 26.9 kDa
Protein Sequence
Protein Sequence
>RC200956 protein sequence
Red=Cloning site Green=Tags(s)

MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA
RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE
DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK
AEQDERKREEEERRLRQAAFQKLKANFNT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079478
RefSeq Size 2000
RefSeq ORF 717
Synonyms MST133; MSTP133; PP3051; SWS2
Locus ID 80303
UniProt ID Q9BUP0
Cytogenetics 2q37.1
Summary This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFHD1" proteins (3)
SKU Description Size Price
LC403060 Lyophilized EFHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403060 Transient overexpression lysate of EF-hand domain family, member D1 (EFHD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300956 Recombinant protein of human EF-hand domain family, member D1 (EFHD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products