DPCD (NM_015448) Human Mass Spec Standard

SKU
PH300890
DPCD MS Standard C13 and N15-labeled recombinant protein (NP_056263)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200890]
Predicted MW 23.2 kDa
Protein Sequence
Protein Sequence
>RC200890 protein sequence
Red=Cloning site Green=Tags(s)

MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGD
PAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKF
SIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056263
RefSeq Size 858
RefSeq ORF 609
Locus ID 25911
UniProt ID Q9BVM2
Cytogenetics 10q24.32
Summary This gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary dyskinesia. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:DPCD (NM_015448) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414547 DPCD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414547 Transient overexpression lysate of deleted in primary ciliary dyskinesia homolog (mouse) (DPCD) 100 ug
$436.00
TP300890 Recombinant protein of human deleted in a mouse model of primary ciliary dyskinesia (RP11-529I10.4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.