OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DPCD (NM_015448) Human Mass Spec Standard

Be the first to review this product
SKU
PH300890
DPCD MS Standard C13 and N15-labeled recombinant protein (NP_056263)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505898 DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9) 100 ul
$447.00
LY414547 Transient overexpression lysate of deleted in primary ciliary dyskinesia homolog (mouse) (DPCD) (as WB positive control) 100 ug
$436.00

Other products for "DPCD or NM_015448"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200890
Predicted MW 23.2 kDa
Protein Sequence
Protein Sequence
>RC200890 protein sequence
Red=Cloning site Green=Tags(s)

MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGD
PAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKF
SIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056263
RefSeq Size 858
RefSeq ORF 609
Locus ID 25911
UniProt ID Q9BVM2
Cytogenetics 10q24.32
Summary This gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary dyskinesia. provided by RefSeq, Jul 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DPCD" proteins (3)
SKU Description Size Price
LC414547 Lyophilized DPCD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414547 Transient overexpression lysate of deleted in primary ciliary dyskinesia homolog (mouse) (DPCD) (as WB positive control) 100 ug
$436.00
TP300890 Recombinant protein of human deleted in a mouse model of primary ciliary dyskinesia (RP11-529I10.4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products