OBFC2B (NABP2) (NM_024068) Human Mass Spec Standard

SKU
PH300876
OBFC2B MS Standard C13 and N15-labeled recombinant protein (NP_076973)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200876]
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC200876 protein sequence
Red=Cloning site Green=Tags(s)

MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRL
TKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGP
SAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSK
R

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076973
RefSeq Size 1404
RefSeq ORF 633
Synonyms hSSB1; OBFC2B; SOSS-B1; SSB1
Locus ID 79035
UniProt ID Q9BQ15
Cytogenetics 12q13.3
Summary Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2B, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplied by OMIM, Jun 2008]
Write Your Own Review
You're reviewing:OBFC2B (NABP2) (NM_024068) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411384 NABP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411384 Transient overexpression lysate of oligonucleotide/oligosaccharide-binding fold containing 2B (OBFC2B) 100 ug
$436.00
TP300876 Recombinant protein of human oligonucleotide/oligosaccharide-binding fold containing 2B (OBFC2B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.